PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00117875001
Common NameGSBRNA2T00117875001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 338aa    MW: 38164.5 Da    PI: 6.8844
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00117875001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.11.3e-30192247156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k r++W++eLH+rF++ ++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00117875001 192 KHRRCWSHELHRRFLNTLKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 247
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-27189250IPR009057Homeodomain-like
PROSITE profilePS5129414.371189249IPR017930Myb domain
SuperFamilySSF466896.07E-17190250IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26192247IPR006447Myb domain, plants
PfamPF002491.3E-5194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MINSLSNMKN YNEKRVRCCE YIKALEEERR KINVFQRELP LCLELVTQAI ETYKKEISEA  60
TMENLCGQSE CSEQTTGECG GILDLFRPIK HSSTSLEGEE EEVDADDEHE SNETGLDCDD  120
KNMKSEWLKS VQLWNQPDSV LSKKLERSQQ ETETVVEAIN GNDNGTTSHQ PPCYETSNGK  180
SGDDKSQARR RKHRRCWSHE LHRRFLNTLK QLGGPHVATP KQIRELMKVD GLTNDEVKSH  240
LQKYRLHTRR PGQTIPNKRD SQTQHFVVVG GIWVPQASHS TANAATAGET TIGIYGPLQA  300
EWPSQSNFGR TISEERSRCS NKGIIRCSSP AMSSSTR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.46430.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00117875001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114112.10.0PREDICTED: uncharacterized protein LOC103839360 isoform X1
RefseqXP_009114113.10.0PREDICTED: uncharacterized protein LOC103839360 isoform X2
RefseqXP_013740561.10.0PREDICTED: uncharacterized protein LOC106443554 isoform X1
TrEMBLA0A078EQF20.0A0A078EQF2_BRANA; BnaA09g19580D protein
STRINGBra017349.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.11e-161G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]